Allergen

ABG81314.1

Accession ABG81314.1
Species Zea mays
Common Name Corn
Description pollen profilin variant 3 [Zea mays]
IUIS Name
Gi 0110644956
Length 131
Year Adopted 2008
Sequence >ABG81314.1 Putative pollen profilin variant 3 [Zea mays]
MSWQAYVDEHLMCEIEGHHLTSAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL
APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE
RLGDYLLKQGL
Parent Accession