Powered by FoodRisk.org

Allergen

ABL09307.1

Accession ABL09307.1
Species Acarus siro
Common Name Mite
Description allergen Aca s 13 [Acarus siro]
Gi 0118638268
Length 131
Year Adopted 2009
Sequence >accession|ABL09307.1|Putative allergen Aca s 13 [Acarus siro]
MVQINGSYKLEKSDNFDAFLKELGLNFVTRNLAKSATPTVEVSVNGDSYTIKTASTLKNT
EISFKLGEEFEEARADGKTVKTVVNKESDTKFVQVQQGDKEVTIVREFSDEGLTVTATVN
GVTSVRFYKRQ