Powered by FoodRisk.org

Allergen

ABL09312.1

Accession ABL09312.1
Species Acarus siro
Common Name Mite
Description allergen Aca s 4 [Acarus siro]
Gi 0118638278
Length 517
Year Adopted 2009
Sequence >accession|ABL09312.1|Putative allergen Aca s 4 [Acarus siro]
MAHLLLAVVAITLALSQSVFGGSPYSNPHFTGSRSVITHLMQWKFDDIAAECERFLGPKG
YGGIQLSPVNEHAVLGNRPWYELYQPVGYKIQSRSGNEEQFKGMVQRCNKVGVRIYVDIV
MNHMSGAQEGHGNCWFKLQWHHDVSRCSLLVPNDFHGRESCHTDNMDIKNYDNPEEARNC
RLSGLRDLKQSSEYVRQKQADFLNHLIDLGVAGSRSDASKHMWPGDLEAIYGKLHNLNTA
YFPANSRPFIYHEVIYYGGDGIKSSDYTKLGRAIEFHFYRDIANVVRRHNQLKTVKNFGQ
PWGMVPSDDALVMVDSHDLQRFHTGQVGVNINYFESRLLKVATAFMLAWPYGVPRVMSSY
HWDQKIEDGKDKNDWIGPPSDGSGNILSVTPQPDDTCNKEWICEHRWRQIYNMVHFRNVA
GNEAVSHWWDNGDYQIAFGRGSKAFIAINLQDGQGLNRKLATGLPQGTYCDLVTGNLAGG
KCTGGTVTVDGSGNADINIAKTAEDPFVAIHVEAKLH