Allergen

ABL77410.1

Accession ABL77410.1
Species Anisakis simplex
Common Name Parasitic fish worm
Description unknown
IUIS Name Ani s 7
Gi 0119524036
Length 1096
Year Adopted 2009
Sequence >ABL77410.1 Allergen Ani s 7; unknown [Anisakis simplex]
AKYGSQFCKNLLANCLSSTGATLPMQSPWQIPPVVSSCITSGMAKGTDHNKKDVMATCIQ
RYGADFCKNMVGSCAALTDVTLTSYGIGSVLPQVIVDCMTSEMSSPSIMWQCVQKYGTEF
CKKLLQDCSASTGASLSPQAPWLIPSVIAECMAKGMVNGGRQADDTMAICIQKYGIKFCN
IIGAACSVLTQVPFFPQLPGTVQQLPSELRACVRSETQKPNVMTKCVEKYGTEFCSSLLQ
SCSASTGAILPLREPWKIPHPIADCMYAGMNPESKEDRGGIMSKCIRRYGFDFCKKMLES
CSALTSVQHDSRNTNYASLPQVLKDCMASEMDSPSVMFECVQRYGTPFCKGLLETCTEKT
RASLSPQAPWLIPTAIAQCMRQGMNQGDEKKTLMSLCVRRYGADYCNNLAAACSVLTNLP
FFPQTPPSEQNLPPMMHKCLKSEMENPGIMSTCVQRYGTQFCKNLLNSCTASTGMHLPYD
APWKIPEPIAACMAQGMNGGDHKPKEDAMARCIRKYGVTYCNNMLASCSVLTNVNYDPSG
GQMPGILSECVTAETDEPSAMCQCVQKYGTEFCKKRLASCIASTGMNLPATTPWKLPPPV
ARCMQHGSPNDNRGQGQGSNDVMSQCIARYGAEFCQRLARFCYAMNSLQYPGETFDPQQQ
TPTQVARCMKSEMDSPSVMWHCVQKYGQEFCNKLAATCSTETNTPLPQQDPWRLPQPIIA
CMLGKMNNPNPTSKPQSVMSQCTARYGDDFCLSLGKACAELNNVPSSMISLSAQQLPQPV
SSCMKAEMNNPSALWQCIQQYGIEFCKKLRDACSAMTGASLSTTTPWILPQPVSNCMRNE
MNNPSAMWLCIQKYGIEFCNRLASACAMIKKVTMPTVTINLPEIIASCVASENSQAMCYA
RKGPEQCKTEENICRNPNNPPGSPLTIPETECMKSQVAMATCQKKFGSECVALQQECVAG
TGAPPVTIGARGAFMLATALRSCIFNGGVIGSCVLYHPPSQCDQWVQQCATALQTSAGVT
VAGGYRQLSPPMAVCVASQDLMTRCMTRLGQGTCQQAVKNCKRRFNTPSSRLPGRLWSLS
SELINCLYRPVNRASN
Parent Accession