Allergen

ABM53752.1

Accession ABM53752.1
Species Tyrophagus putrescentiae
Common Name dust mite
Description fatty acid-binding protein
IUIS Name Tyr p 13
Gi
Length 161
Year Adopted 2022
Sequence >ABM53752.1 Allergen Tyr p 13; fatty acid-binding protein [Tyrophagus putrescentiae]
MANKLLLALALVLAATTSAVLAEDIDFSGRYKMTVADTSNYKDLLYELGIGYFKRLAAGA
SGSEYVITRNKEAGTYTLQTVTTFSTAAVTFKSGEEFDEPRADGQTVKSTIVIAGNKWTH
VQKGSPTVTIERTFQGGNPPTYIDVITKCNAVPVTRKYERQ
Parent Accession