Powered by FoodRisk.org

Allergen

ABU42022.1

Accession ABU42022.1
Species Pistacia vera
Common Name pistachio
Description 11S globulin [Pistacia vera]
Gi 0156001070
Length 472
Year Adopted 2009
Sequence >accession|ABU42022.1|Putative 11S globulin [Pistacia vera]
MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESE
AGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYNNAPELVYVVQGSGIHGAVFPGCP
ETFQEESQSQSRSQHSRSERSQQSGEQHQKVRHIREGDIIALPAGVAHWIYNNGQSKLVL
VALADVGNSENQLDQYLRKFVLGGSPQQEIQGGGQSWSQSRSSRKGQQSNNILSAFDEEI
LAQSLNIDTQLVKKLQREEKQRGIIVRVKEDLQVLSPQRQEKEYSDNGLEETFCTMTLKL
NINDPSRADVYNPRGGRVTSINALNLPILRFLQLSVEKGVLYQNAIMAPHWNMNAHSIVY
ITRGNGRMQIVSENGESVFDEEIREGQLVVVPQNFAVVKRASSDGFEWVSFKTNGLAKIS
QLAGRISVMRGLPLDVIQNSFDISREDAWNLKESRSEMTIFAPGSRSQRQRN