Allergen

ABU97467.1

Accession ABU97467.1
Species Blomia tropicalis
Common Name mite
Description apolipophorin
IUIS Name
Gi
Length 744
Year Adopted 2022
Sequence >ABU97467.1 apolipophorin [Blomia tropicalis]
MSAVGTANSHEHLAQLEVTYPKDAPKEVKLLLKSPENSFETKFALNLDASRNLDIKLNLP
HLIDIHLKNQFEKDKETNLMKNDMVLEYKFPNDETVHTLKTHHELGYNLKRNGKDKVANF
DFKSKFESSRRPFLNHRSLVQFKYRPYKLQELVLEFGYGEKMDNVYKFSRISKIDVQEFK
PFKMNSETDLNIVATDFDVDYEIKADNRVLNDRGNALEFDMNLKGKDRSKRAAENGNQEI
EGKIKYRNKGSAVDSKLEASLKGVGHDFAWNSELKQVEPQKYEGKITIQTEKDKKIFITH
KEEISKPTKEIHFKSEADISYSYKPDKKTYVMEAKKQGTAYILKGEAKKDGTVIFSNDIN
FESSNGNLKALIKRDTRSYDLNVDNVFRPREATLLFKIKDREYNIKMDREPFKYINLKVD
GNENALIKNGKAHLSIMDPTTLNLVTKANSNVDFSMDLFASIRHQIALKIDSPKYNFFHD
GDIDLSIVNRRLLWKSLTKKDDREYKFNADIARKGSMISLTKVTPDRTSSVQYSRNGEKI
EVNIDTEYLEGKVEGDRFSGKIVLKNKQNDYELESTYKRENGRLVIESVNGKNAKMEAVF
SRKEPSKFVLETPNTKAKIDMDLTAPVKTFKLDFDNPRYQKKIDASMEPESKFKYSSYSN
QKNEKKERKIEIDGVHMKELNVDIDFPDFKFKVKQPESSKKVEFSYTFNNYTETEEYDFD
PHKAYLVNWVNALRQYVQTFVVQN
Parent Accession