Powered by FoodRisk.org

Allergen

ABW86978.1

Accession ABW86978.1
Species Carya illinoinensis
Common Name Pecan
Description 11S legumin protein [Carya illinoinensis]
Gi 0158998780
Length 505
Year Adopted 2014
Sequence >accession|ABW86978.1|Putative 11S legumin protein [Carya illinoinensis]
MAKPILLSIYLCLIIVALFNGCLAQSGGRQQHKFGQCQLNRLDALEPTNRIEAEAGVIES
WDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNAPQLVYIARGRGITGVLFPGCPETFEES
QRQSQQGQRREFQQDRHQKIRHFREGDIIAFPAGVAHWCYNDGSSPVVAIFLLDTHNNAN
QLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRRGEHGEQQRDLGNNVFSGFDA
EFLADAFNVDTETARRLQSENDHRGSIVRVEGRQLQVIRPRWSREEQEHEERKERERERE
SESERRQSRRGGRDDNGLEETICTLSLRENIGDPSRADIYTEEAGRISTVNSHNLPILRW
LQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTI
PQNFAVVKRARDEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLVNAFQIPREDARRL
KFNRQESTLVRSRSRSSRSERRAEV