Allergen

ABW86978.1

Accession ABW86978.1
Species Carya illinoinensis
Common Name Pecan
Description 11S globulin/ legumin -like protein
IUIS Name Car i 4
Gi 0158998780
Length 505
Year Adopted 2014
Sequence >ABW86978.1 Allergen Car i 4; 11S globulin/ legumin-like protein [Carya illinoinensis]
MAKPILLSIYLCLIIVALFNGCLAQSGGRQQHKFGQCQLNRLDALEPTNRIEAEAGVIES
WDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNAPQLVYIARGRGITGVLFPGCPETFEES
QRQSQQGQRREFQQDRHQKIRHFREGDIIAFPAGVAHWCYNDGSSPVVAIFLLDTHNNAN
QLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRRGEHGEQQRDLGNNVFSGFDA
EFLADAFNVDTETARRLQSENDHRGSIVRVEGRQLQVIRPRWSREEQEHEERKERERERE
SESERRQSRRGGRDDNGLEETICTLSLRENIGDPSRADIYTEEAGRISTVNSHNLPILRW
LQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTI
PQNFAVVKRARDEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLVNAFQIPREDARRL
KFNRQESTLVRSRSRSSRSERRAEV
Parent Accession