Powered by FoodRisk.org

Allergen

ACB55491.1

Accession ACB55491.1
Species Sesamum indicum
Common Name Sesame
Description seed maturation-like protein precursor [Sesamum indicum]
Gi 0171853012
Length 345
Year Adopted 2016
Sequence >accession|ACB55491.1|Putative seed maturation-like protein precursor [Sesamum indicum]
MQFFSSRLLGSSRVLATTLSHFHYNPCTNKAHFTKAQLLPAAPYSNKLVIRSMASSGQQF
PPQKQEGQPGKEHIMDPTPQATTPEYKPANKLVGKVALVTGGDSGIGRAVGHCFALEGAT
VAFTYVKGQEDKDANDTLGMLMKAKHADAKDPIAIPTDLGYDENCRRVVEEVVNNYGRID
ILVNNAAEQYEASTVEEIDEPRLERVFRTNIFSYFFTSRHALKHMKEGSSIINTTSVNAY
KGNAKLLDYTATKGAIVAFTRGLALQMVEKGIRVNGVAPGPIWTPLIPASFTEDENAKFG
SQTPMKRAGQPHEVAPSYVFLASNIDSSYITGQVLHPNGGTIVNG