Powered by FoodRisk.org

Allergen

ACE80974.1

Accession ACE80974.1
Species Prunus dulcis
Common Name Almond
Description putative allergen Pru du 2.02 [Prunus dulcis]
IUIS Name
Gi 0190613941
Length 241
Year Adopted 2010
Sequence >ACE80974.1 Allergen putative allergen Pru du 2.02 [Prunus dulcis]
MMKTLVVVLSLSLTLLSFGGAHAATISFKNNCPYTVWPASFGNPQLSTTGFELPSQASFP
LDTPAPWSGRFWARTGCTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQ
DYYDVSLVDGFNLRMSVTPQGGTGTCKTGSCAANVNAVCPSELQKIGSDGSVVACLSACV
KFNQPQYCCTPPQETKEKCPPTNYSQIFHDQCPDAYSYAYDDNKGLFTCSGGPNYLITFC
P
Parent Accession