Allergen

ACG59281.1

Accession ACG59281.1
External DB Link NCBI Protein
Species Triticum aestivum
Common Name wheat
Description alpha-amylase inhibitor
IUIS Name Tri a 40
Length 143
Year Adopted 2010
Sequence >ACG59281.1 Tri a 40; alpha-amylase inhibitor [Triticum aestivum]
MASESNCVLLLAAVLVSIFAAVAAIGNEDCTPWMSTLITPLPSCRDYVEQQACRIETPGS
PYLAKQQCCGELANIPQQCRCQALRYFMGPKSRPDQSGLMELPGCPREVQMDFVRILVTP
GYCNLTTVHNTPYCLAMEESQWS
Parent Accession

Related Articles

Pubmed Authors Title Journal
2102817 Gautier,M.F.; Alary,R.; Joudrier,P. Cloning and characterization of a cDNA encoding the wheat (Triticum durum Desf.) CM16 protein Plant Mol. Biol. 14 (3), 313-322 (1990)
1932681 Lullien,V.; Alary,R.; Guirao,A.; Joudrier,P.; Gautier,M.F. Isolation and nucleotide sequence of a cDNA-clone encoding the bread wheat (Triticum aestivum L.) CM17 protein Plant Mol. Biol. 170, 1081-1082 (1991)
1736890 Sanchez-Monge,R.; Gomez,L.; Barber,D.; Lopez-Otin,C.; Armentia,A.; Salcedo,G. Wheat and barley allergens associated with baker's asthma. Glycosylated subunits of the alpha-amylase-inhibitor family have enhanced IgE-binding capacity Biochem. J. 281 (Pt 2), 401-405 (1992)
8334538 Armentia A; Sanchez-Monge R; Gomez L; Barber D; Salcedo G In vivo allergenic activities of eleven purified members of a major allergen family from wheat and barley flour. Clin Exp Allergy. 1993 May;23(5):410-5
16364168 Weichel M; Vergoossen NJ; Bonomi S; Scibilia J; Ortolani C; Ballmer-Weber BK; Pastorello EA; Crameri R Screening the allergenic repertoires of wheat and maize with sera from double-blind, placebo-controlled food challenge positive patients. Allergy. 2006 Jan;61(1):128-35