Allergen

ACK76291.1

Accession ACK76291.1
External DB Link NCBI Protein
Species Dermatophagoides farinae
Common Name house dust mite
Description trypsin
IUIS Name Der f 3
Length 259
Year Adopted 2010
Sequence >ACK76291.1 Der f 3; trypsin [Dermatophagoides farinae]
MMILTIVVLLAANTWATPILPSSPNATIVGGVKAKAGDCPYQISLQSSSHFCGGSILDEY
RILTAAHCVNGQSAKKLSIRYNTLKHASGGEKIQVAEIYQHENYDSMTIDNDVALIKLKT
PMTLDQTNAKPVPLPPQGSDVKVGDKIRVSGWGYLQEGSYSLPSELQRVDIDVVSREQCD
QLYSKAGADVSENMICGGDVANGGVDSCQGDSGGPVVDIATKQIVGIVSWGYGCARKGYP
GVYTRVGNFVDWIESKRSQ
Parent Accession

Related Articles

Pubmed Authors Title Journal
2732406 Heymann,P.W.; Chapman,M.D.; Aalberse,R.C.; Fox,J.W.; Platts-Mills,T.A. Antigenic and structural analysis of group II allergens (Der f II and Der p II) from house dust mites (Dermatophagoides spp) J. Allergy Clin. Immunol. 83 (6), 1055-1067 (1989)
8563488 Smith,W.A.; Thomas,W.R. Comparative analysis of the genes encoding group 3 allergens from Dermatophagoides pteronyssinus and Dermatophagoides farinae Int. Arch. Allergy Immunol. 109 (2), 133-140 (1996)
8876548 King C; Simpson RJ; Moritz RL; Reed GE; Thompson PJ; Stewart GA The isolation and characterization of a novel collagenolytic serine protease allergen (Der p 9) from the dust mite Dermatophagoides pteronyssinus. J Allergy Clin Immunol. 1996 Oct;98(4):739-47
1537598 Stewart GA; Ward LD; Simpson RJ; Thompson PJ The group III allergen from the house dust mite Dermatophagoides pteronyssinus is a trypsin-like enzyme. Immunology. 1992 Jan;75(1):29-35
18220991 Thomas WR; Heinrich TK; Smith WA; Hales BJ Pyroglyphid house dust mite allergens. Protein Pept Lett. 2007;14(10):943-53