Allergen

ACK76297.1

Accession ACK76297.1
External DB Link NCBI Protein
Species Dermatophagoides farinae
Common Name house dust mite
Description chymotrypsin, serine protease
IUIS Name Der f 6
Length 279
Year Adopted 2010
Sequence >ACK76297.1 Der f 6; chymotrypsin, serine protease [Dermatophagoides farinae]
MIKIFLVTILIVITVTVDARFPRSLQPKWAYLDSNEFSRSKIGDSPIAGVVGGQDADLAE
APFQISLLKDYLIMKSHMCGGSLISESTVVTAAHCTYGQKASSLSVRYGTNQRTSSSYGD
LKVKTIIQHESYDPDTIQNDISLLILSKPVVPSTNVQMIEIETDDIVDGDKVTIYGWGLT
DGNGKDLPDKLQKGSMTIVGNDRCNEKWGSIDAIHPGMICALDKTQSGCNGDSGGPLVSA
NRKLTGIVSWGPSKCPPGEYMSVFTRPKYYLDWITKNIV
Parent Accession

Related Articles

Pubmed Authors Title Journal
8334537 Yasueda,H.; Mita,H.; Akiyama,K.; Shida,T.; Ando,T.; Sugiyama,S.; Yamakawa,H. Allergens from Dermatophagoides mites with chymotryptic activity Clin. Exp. Allergy 23 (5), 384-390 (1993)
10381565 Kawamoto,S.; Mizuguchi,Y.; Morimoto,K.; Aki,T.; Shigeta,S.; Yasueda,H.; Wada,T.; Suzuki,O.; Jyo,T.; Ono,K. Cloning and expression of Der f 6, a serine protease allergen from the house dust mite, Dermatophagoides farinae Biochim. Biophys. Acta 1454 (2), 201-207 (1999)
8911700 Bennett BJ; Thomas WR Cloning and sequencing of the group 6 allergen of Dermatophagoides pteronyssinus. Clin Exp Allergy. 1996 Oct;26(10):1150-4
18220991 Thomas WR; Heinrich TK; Smith WA; Hales BJ Pyroglyphid house dust mite allergens. Protein Pept Lett. 2007;14(10):943-53