Powered by FoodRisk.org

Allergen

ACY38525.1

Accession ACY38525.1
Species Canis familiaris
Common Name Dog
Description allergen Can f 4 precursor [Canis lupus familiaris]
Gi 0262232390
Length 174
Year Adopted 2012
Sequence >accession|ACY38525.1|Putative allergen Can f 4 precursor [Canis lupus familiaris]
MKILLLCLALVLASDAQLPLPNVLTQVSGPWKTLYISSNNLDKIGDNGPFRIYMRGINVD
IPRLKMSFNFYVKVDGECVENSVGASIGRDNLIKGEYNGGNYFRIIDMTPNALIGYDVNV
DSKGKITKVALLMGRGAHVNEEDIAKFKKLSREKGIPEENIIYLGDTDNCPNHE