Allergen

ACY38525.1

Accession ACY38525.1
External DB Link NCBI Protein
Species Canis familiaris
Common Name dog
Description lipocalin
IUIS Name Can f 4
Length 174
Year Adopted 2012
Sequence >ACY38525.1 Can f 4; lipocalin [Canis familiaris]
MKILLLCLALVLASDAQLPLPNVLTQVSGPWKTLYISSNNLDKIGDNGPFRIYMRGINVD
IPRLKMSFNFYVKVDGECVENSVGASIGRDNLIKGEYNGGNYFRIIDMTPNALIGYDVNV
DSKGKITKVALLMGRGAHVNEEDIAKFKKLSREKGIPEENIIYLGDTDNCPNHE
Parent Accession

Related Articles

Pubmed Authors Title Journal
15479273 Saarelainen S; Taivainen A; Rytkonen-Nissinen M; Auriola S; Immonen A; Mantyjarvi R; Rautiainen J; Kinnunen T; Virtanen T Assessment of recombinant dog allergens Can f 1 and Can f 2 for the diagnosis of dog allergy. Clin Exp Allergy. 2004 Oct;34(10):1576-82
20545700 Mattsson,L.; Lundgren,T.; Olsson,P.; Sundberg,M.; Lidholm,J.; Molecular and immunological characterization of Can f 4: a dog dander allergen cross-reactive with a 23 kDa odorant-binding protein in cow dander Clin. Exp. Allergy 40 (8), 1276-1287 (2010)