Powered by FoodRisk.org

Allergen

ACY40650.1

Accession ACY40650.1
Species Blattella germanica
Common Name German cockroach
Description allergen Bla g 3 isoform 1 precursor [Blattella germanica]
Gi 0262272875
Length 657
Year Adopted 2011
Sequence >accession|ACY40650.1|Putative allergen Bla g 3 isoform 1 precursor [Blattella germanica]
IPADKVFLRKQWDVLRLVHRIHQHSIIPEQVTVGDSYDIEANINNYKNPRVVKNFMALYK
KDPVKRGEPFSTYYIKHREQAIMLFELFYYANDYDTFYKTACWARDRVNEGMFLYSFNIA
IMHREDMQDIVIPAFYEIYPFLFVENDVIQKAYDYKMKESGHLNEPHTHVIPVNFTLRNQ
EQLLSYFTEDVFLNAFNTYFRYMYPTWFNYTKYEYDVPRHGEQFYYFYQQIYARYMLERY
SNDMPDIKPFTYNKAFKTPYNPQLRYPNGQEVPARPAYMVPQDFDLYYVSDIKNYERRVA
DAIDFGYVFCDKMISHSLYNDKKGFEMLAEIIEGNSMHPDYYGHIFHMYRSLLGHVTDPF
HKNGEAPSALEHPETALRDPAFYQIWKRVQHYFYKFQMKLPYYTREELTFDGVKIDNVDV
GKLYTYFEPYEMSLGYSVKVENIQDAANVDIRARNYRLNHKPFTYNIEVTSEKETPVYVR
VFLGPKYNYYGHEYDLNERRNKFVEIDRFPYQLHAGKNAIERNSHESTVVAKEQDTPKVL
YKKVNEAYEGKATYNYDKQTKFCGLPEHLLIPKGKKGGQAFTVYVIVTPYDKAVEKEEHH
FKAYSYCGVGPHDTYPDDKPLGFPFDRPIHSYDFVTPNMFMKDVFIFHKKYEEVEQH