Powered by FoodRisk.org

Allergen

ACY40651.1

Accession ACY40651.1
Species Blattella germanica
Common Name German cockroach
Description allergen Bla g 3 isoform 2 precursor [Blattella germanica]
Gi 0262272877
Length 657
Year Adopted 2011
Sequence >accession|ACY40651.1|Putative allergen Bla g 3 isoform 2 precursor [Blattella germanica]
IPADKVFLRKQWDVLRLVHRIHQHSIIPEQVTVGDSYDIEANINNYKNPRVVKNFMALYK
KDPVKRGEPFSTYYIKHREQAIMLFELFYYANDYDTFYKTACWARDRVNEGMFLYSFNIA
IMHREDMQDIVVPAFYEIYPFLFVENDVIQKAYDYKMKESGHLNEPHTHVIPVNFTLRNQ
EQLLSYFTEDVFLNAFNTYFRYMYPTWFNYTKYEYDVPRHGEQFYYFNQQMFARYMLERY
SNDMPEIQPFTYTKPFKTPYNPQLRYPNGQEVPARPAYMMPQDFDLMYVSDIKNYEKRVA
DAVDFGYVFCDKMISHSLYNNEKGLEWLGQIVEGNSMHPDFYGHIFHMYRSLLGHITDPF
HKHGVAPSALEHPETSLRDPAFYQIWKRVQHYFNKFQMKQPYYTREELAFDGVKIDNVDV
GKLYTYFEPYEMGLSNAVKVGKLEDVPNVDIRARNYRLNHKPFTYNVEVTSEKDTPVYVR
VFLGPKYNYYGHEYDLNERRNYFVEIDRFPYQLHTGKNTIQRNSHDSSVVAQEQDTYKVL
YKKVNEAYEGKTTYTYEKQDKYCGLPEHLLIPKGKKGGQAFTVYVIVTPYDKAVEKEEHH
FKAYSYCGVGPHDSVYDKKPLGFPFDRPIHSYDFVTPNMFMKDVFIFHKKYEEVEQH