Allergen

ADD18879.1

Accession ADD18879.1
External DB Link NCBI Protein
Species Glossina morsitans
Common Name tsetse fly
Description unknown function, antigen 5
IUIS Name Glo m 5
Length 258
Year Adopted 2011
Sequence >ADD18879.1 Glo m 5; unknown function, antigen 5 [Glossina morsitans]
MKFVLATLNLLVLVSAGSVDYCNLCEKHVACVSQNVFQSGCSSDAKMIDLKKYQTTLLDA
HNKKRDNVAGGGESKLKRACRMATMKWNSELAKLAEYNVRQCEMNHDKCRNTNTFKYAGQ
NLAELGRSGAGTPDYGQLIQKAVDSWYEEVNDCNQGYIDSYPKDYKGPAIGHFTVMVAER
NTHMGCAASQYTRSNGFTYFLLACNYATTNMMEFPIYKSCSASAQDCKTGKNSKYQNLCS
ANEKYEVNRWFKDGVEYQ
Parent Accession

Related Articles

Pubmed Authors Title Journal
19507303 Caljon G; Broos K; De Goeyse I; De Ridder K; Sternberg JM; Coosemans M; De Baetselier P; Guisez Y; Den Abbeele JV Identification of a functional Antigen5-related allergen in the saliva of a blood feeding insect, the tsetse fly. Insect Biochem Mol Biol. 2009 May-Jun;39(5-6):332-41
17785195 Van Den Abbeele J; Caljon G; Dierick JF; Moens L; De Ridder K; Coosemans M The Glossina morsitans tsetse fly saliva: general characteristics and identification of novel salivary proteins. Insect Biochem Mol Biol. 2007 Oct;37(10):1075-85
20353571 Alves-Silva J; Ribeiro JM; Van Den Abbeele J; Attardo G; Hao Z; Haines LR; Soares MB; Berriman M; Aksoy S; Lehane MJ An insight into the sialome of Glossina morsitans morsitans. BMC Genomics. 2010 Mar 30;11:213