Allergen

ADG36438.1

Accession ADG36438.1
Species Musa acuminata
Common Name Banana
Description glucanase
IUIS Name Mus a 5
Gi
Length 312
Year Adopted 2021
Sequence >ADG36438.1 Allergen Mus a 5; glucanase [Musa acuminata]
IGVCYGMLGNNLPPPSEVVSLYKSNDIARMRLYDPNQAALQALRNSNI
QVLLDVPRSDVQSLASNPSAAGDWIRRNVVAYWPSVSFRYIAVGNELI
PGSDLAQYILPAMRNIYNALSSAGLQNQIKVSTAVDTGVLGTSYPPSA
GAFSSAAQAYLSPIVQFLASNGAPLLVNVYPYFSYTGNPGQISLPYAL
FTASGVVVQDGRFSYQNLFDAIVDAVFAALERVGGANVAVVVSESGWP
SAGGGAEASTSNAQTYNQNLIRHVGGGTPRRPGKEIEAYIFEMFNENQ
KAGGIEQNFGLFYPNKQPVYQMSF
Parent Accession