Powered by FoodRisk.org

Allergen

ADN39440.1

Accession ADN39440.1
Species Prunus dulcis
Common Name Almond
Description 11S globulin / legumn-like protein / amandin / prunin
IUIS Name Pru du 6
Gi 0307159112
Length 551
Year Adopted 2015
Sequence >ADN39440.1 Allergen Pru du 6; 11S globulin / legumn-like protein / amandin / prunin [Prunus dulcis]
MAKAFVFSLCLLLVFNGCLAARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQ
EDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQ
QGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQ
QQQFRQFDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPR
KFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGSGNNVFSGFNTQLL
AQALNVNEETARNLQGQNDNRNQIIRVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQ
GGQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGF
FYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQ
AGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIA
LSSSQQRRAVV
Parent Accession