Allergen

ADN39441.1

Accession ADN39441.1
External DB Link NCBI Protein
Species Prunus dulcis
Common Name almond
Description 11S globulin, cupin
IUIS Name Pru du 6
Length 504
Year Adopted 2015
Sequence >ADN39441.1 Pru du 6; 11S globulin, cupin [Prunus dulcis]
CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA
VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF
RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD
LNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQA
LNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEK
QREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLR
LSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQ
NHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKY
NRQESRLLSATSPPRGRLMSILGY
Parent Accession

Related Articles

Pubmed Authors Title Journal
19694440 Jin,T.; Albillos,S.M.; Guo,F.; Howard,A.; Fu,T.J.; Kothary,M.H.; Zhang,Y.Z.; Crystal structure of prunin-1, a major component of the almond (Prunus dulcis) allergen amandin J. Agric. Food Chem. 57 (18), 8643-8651 (2009)
19374443 Albillos SM; Menhart N; Fu TJ Structural stability of Amandin, a major allergen from almond (Prunus dulcis), and its acidic and basic polypeptides. J Agric Food Chem. 2009 Jun 10;57(11):4698-705
11308365 Sathe SK; Teuber SS; Gradziel TM; Roux KH Electrophoretic and immunological analyses of almond (Prunusdulcis l.) genotypes and hybrids. J Agric Food Chem. 2001 Apr;49(4):2043-52
11368566 Roux KH; Teuber SS; Robotham JM; Sathe SK Detection and stability of the major almond allergen in foods. J Agric Food Chem. 2001 May;49(5):2131-6
N/A: See Journal Bargman TJ, Rupnow JH, Taylor SL IgE-Binding proteins in almonds (Prunus amygdalus); identification by immunoblotting with sera from almond-allergic adults J Food Sci 57(3):717-720
21720172 Willison LN; Tripathi P; Sharma G; Teuber SS; Sathe SK; Roux KH Cloning, expression and patient IgE reactivity of recombinant Pru du 6, an 11S globulin from almond. Int Arch Allergy Immunol. 2011;156(3):267-81