Powered by FoodRisk.org

Allergen

ADN39441.1

Accession ADN39441.1
Species Prunus dulcis
Common Name Almond
Description 11S globulin / legumn-like protein / amandin / prunin
IUIS Name Pru du 6
Gi 0307159114
Length 504
Year Adopted 2015
Sequence >ADN39441.1 Allergen Pru du 6; 11S globulin / legumn-like protein / amandin / prunin [Prunus dulcis]
CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA
VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF
RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD
LNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQA
LNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEK
QREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLR
LSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQ
NHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKY
NRQESRLLSATSPPRGRLMSILGY
Parent Accession