Powered by FoodRisk.org

Allergen

ADW27428.1

Accession ADW27428.1
Species Fagopyrum tataricum
Common Name Buckwheat
Description 16 kDa major allergen [Fagopyrum tataricum]
Gi 0320445237
Length 149
Year Adopted 2012
Sequence >accession|ADW27428.1|Putative 16 kDa major allergen [Fagopyrum tataricum]
MKLFIILATATLLIAATQAKYLRDEGFDLGETQMSSKCTRQVKMMEPELVKCNRYIAMDI
MDDKYEEALSRIQGEGCESEEKFLRGCCVAMKEMEDECVCEWMKMMVENQKGRIGETLMR
KGIRDLKELPNKCGISEMECHSRGNWYYV