Allergen

AFN42528.1

Accession AFN42528.1
Species Cannabis sativa
Common Name hemp
Description pathogenesis related protein, PR-10, Bet v 1-like protein
IUIS Name Can s 5
Gi
Length 161
Year Adopted 2022
Sequence >AFN42528.1 Allergen Can s 5; pathogenesis related protein, PR-10, Bet v 1-like protein [Cannabis sativa]
MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG
QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS
KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN
Parent Accession