Powered by FoodRisk.org

Allergen

AGC39166.1

Accession AGC39166.1
Species Actinidia deliciosa
Common Name Kiwi
Description kiwellin [Actinidia deliciosa]
Gi 0441482350
Length 213
Year Adopted 2014
Sequence >accession|AGC39166.1|Putative kiwellin [Actinidia deliciosa]
MAQLALLLLSLFLTLISLAPPGASISSCNGPCRDLNDCDGQLICIKGKCNDDPQVGTHIC
RGTTPSPQPGGCKPSGTLTCRGKSYPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECD
ESYHSNNERIVALSTGWYNGGSRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQP
PCRNNIVDGSNAVWSALGLDKNVGVVDITWSMA