Powered by FoodRisk.org

Allergen

AGC39167.1

Accession AGC39167.1
Species Actinidia deliciosa
Common Name Kiwi
Description kiwellin [Actinidia deliciosa]
Gi 0441482352
Length 213
Year Adopted 2014
Sequence >accession|AGC39167.1|Putative kiwellin [Actinidia deliciosa]
MAQLSLLVLSLFLTLISLPPPGASISSCNGPCRDLNDCDGQLICIEGKCNDDPEVGTHIC
RGTTPSPQPGGCKPSGTLTCRGKSHPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECD
ESYHSNNERIVALSTGWYNGGSRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQP
PCRNNIVDGSNAVWSALGLDKNVGVVDITWSMA