Powered by FoodRisk.org

Allergen

AGC39168.1

Accession AGC39168.1
Species Actinidia chinensis
Common Name Kiwi
Description kiwellin [Actinidia chinensis]
Gi 0441482354
Length 213
Year Adopted 2014
Sequence >accession|AGC39168.1|Putative kiwellin [Actinidia chinensis]
MAQLSLLLLSLFLTLISLPPPGASISSCNGPCRDLNDCDGQLICIKGKCNDDPEVGTHIC
RGTTPSPQPGGCKPSGTLTCQGKSHPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECD
ESYHSNNERIVALSTGWYNGGSRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQP
PCRNNIVDGSNAVWSALGLNKNVGVVDITWSMA