Allergen

AGC39168.1

Accession AGC39168.1
Species Actinidia chinensis
Common Name Kiwi
Description kiwellin
IUIS Name Act c 5
Gi 0441482354
Length 213
Year Adopted 2014
Sequence >AGC39168.1 Allergen Act c 5; kiwellin [Actinidia chinensis]
MAQLSLLLLSLFLTLISLPPPGASISSCNGPCRDLNDCDGQLICIKGKCNDDPEVGTHIC
RGTTPSPQPGGCKPSGTLTCQGKSHPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECD
ESYHSNNERIVALSTGWYNGGSRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQP
PCRNNIVDGSNAVWSALGLNKNVGVVDITWSMA
Parent Accession