Allergen

AGC39172.1

Accession AGC39172.1
Species Actinidia arguta
Common Name Hardy Kiwi
Description kiwellin [Actinidia arguta]
IUIS Name
Gi 0441482362
Length 213
Year Adopted 2014
Sequence >AGC39172.1 Putative kiwellin [Actinidia arguta]
MAQLTLLLLSLFLTLISLPPPGASISSCNGPCRDLNDCDGQLICIKGKCNDDPEVGTHIC
GGTTPSPQPGSCNPSGTLTCQGKSYPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECD
ESYHSNNERIVALSTGWYNGGSRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQP
PCRNNIVDGSNAVWSALGLDKNVGVVDITWSMA
Parent Accession