Powered by FoodRisk.org

Allergen

AGC39173.1

Accession AGC39173.1
Species Actinidia arguta
Common Name Hardy Kiwi
Description kiwellin [Actinidia arguta]
Gi 0441482364
Length 213
Year Adopted 2014
Sequence >accession|AGC39173.1|Putative kiwellin [Actinidia arguta]
MAQLTLLLLSLFFTLISLPPPGASISSCNGPCRDLNDCNGQLICIKGKCNDDPEVGTHIC
GGTTPSPQPGSCKPSGTLTCQGKSYPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECD
ESYHSNNERIVALSTGWYNGGSRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQP
PCRNNIVDGSNAVWSALGLDKNVGVVDITWSMA