Powered by FoodRisk.org

Allergen

AGC39174.1

Accession AGC39174.1
Species Actinidia arguta
Common Name Hardy Kiwi
Description kiwellin [Actinidia arguta]
Gi 0441482366
Length 213
Year Adopted 2014
Sequence >accession|AGC39174.1|Putative kiwellin [Actinidia arguta]
MAQLTLLLLSLFLTLISLPPPGASISSCNGPCRDLNDCDGQLICIKGKCNDDPEVGTHIC
GGTTPSPQPGGCNPSGTLTCQGKSYPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECD
ESYHSNNERIVALSTGWYNGGSRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQP
PCRNNIVDGSNAVWSALGLDKNVGVVDITWSMA