Powered by FoodRisk.org

Allergen

AGC39176.1

Accession AGC39176.1
Species Actinidia chinensis
Common Name Kiwi
Description thaumatin-like protein [Actinidia chinensis]
Gi 0441482370
Length 225
Year Adopted 2014
Sequence >accession|AGC39176.1|Allergen thaumatin-like protein [Actinidia chinensis]
MSTFKSLSLSALLFIAFLFTCARGATFNIINNCPFTVWAAAVPGGGKRLDRGQNWIINPG
AGTKGARVWARTGCNFDGAGRGKCQTGDCNGLLQCQAFGQPPNTLAEYALNQFNNLDFFD
ISLVDGFNVAMEFSPTSGGCTRGIKCTANINEQCPNELRAPGGCNNPCTVFKTDQYCCNS
GNCGPTDYSRFFKTRCPDAYSYPKDDQTSTFTCPGGTNYKVVFCP