Allergen

AGC60028.1

Accession AGC60028.1
Species Anisakis pegreffii
Common Name Parasitic fish worm
Description Ani s 12 allergen [Anisakis pegreffii]
IUIS Name
Gi 0442577849
Length 264
Year Adopted 2014
Sequence >AGC60028.1 Putative Ani s 12 allergen [Anisakis pegreffii]
MVKNLPPSVREQCIESQIVIRDCEEKKYGENCAELIKQCVTITGAPPVTIGGSGQYRVAS
SLRDCIKKGGYMGYCSNFTTPENCIKWKDECAPSEAAEKTDENSLEVFPETFSQCFKSQV
VMQQCMSKGEEECLKIQKECVDAFGTPPVTSAANGAYQMAAPLHRCIENGGWMKMCSTWI
NATICERWKQECSGDKDAELPPNFSQCIQTQMVMLQCNLKFGDKCKALQDECVAATDAPT
VDANPPIFTSKMNTCVKRKMAKGL
Parent Accession