Powered by FoodRisk.org

Allergen

AGR27935.1

Accession AGR27935.1
Species Prunus dulcis
Common Name Almond
Description putative Pru du 6 allergen, partial [Prunus dulcis]
IUIS Name
Gi 0523916668
Length 178
Year Adopted 2015
Sequence >AGR27935.1 Putative putative Pru du 6 allergen, partial [Prunus dulcis]
DNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQFIYIVRGRGVLG
AVFPGCAETFEDSQPQQFQQQQQQQQQFRPSRQEGGQGQQQFQGEDQLDRHQKIRHIREG
DIIALPAGVAYWSYNNGEQPLVAVSLLDLSNDQNQLDQVPRRFYLAGNPQDEFNPQQQ
Parent Accession