Powered by FoodRisk.org

Allergen

AGT28425.1

Accession AGT28425.1
Species Phodopus sungorus
Common Name Siberian hamster
Description odorant-binding protein, partial [Phodopus sungorus]
Gi 0530376029
Length 151
Year Adopted 2016
Sequence >accession|AGT28425.1|Allergen odorant-binding protein, partial [Phodopus sungorus]
NDYAELEGKWDTIAIAADNDAKIKEEGPLRLYVRELYCNEDCSEMEVTFYVNANNQCSKT
TVIGYKQADGTYRTQFEGDNRFQPVYATPENIVFTSKNVDRAGQETNLIFVVGKSQPLTP
EQHEKLVEFAHENNIPEENIHNVLATDTCPK