Powered by FoodRisk.org

Allergen

AHA36627.1

Accession AHA36627.1
Species Corylus avellana
Common Name European hazelnut
Description Cor a 9 allergen [Corylus avellana]
Gi 0557792009
Length 514
Year Adopted 2016
Sequence >accession|AHA36627.1|Allergen Cor a 9 allergen [Corylus avellana]
MAKLILVSFSLCLLVLFNGCLGIDVGLRRQQQRHFGECNLDRLNALEPTNRIEAEAGQIE
SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED
PQQQSQQGQGQGQSQRSEQDRHQKIRYFQEGDIIALPAGVAHWCYNDGDSPVVAVSLLHT
NNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSRGKEGEQEQQGEGNNVFS
GFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQMVRPERSRQEWERQERQERES
EQERERQRRQGGRGRDVNGFEETICSLRLMENIGSRSRADIYTEQVGRINTVNSNTLPVL
RWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQVL
TIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREEAR
RLKYNRQETTLARSSRSSSERMRRRSESEGRAEA