Powered by FoodRisk.org

Allergen

AHF71021.1A

Accession AHF71021.1A
Species Artemisia absinthium
Common Name Absinthe wormwood
Description defensin-like protein, partial sequence
IUIS Name Art ab 1
Gi
Length 55
Year Adopted 2021
Sequence >AHF71021.1A Allergen Art ab 1; defensin-like protein, partial sequence [Artemisia absinthium]
AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSK
Parent Accession AHF71021.1