Powered by FoodRisk.org

Allergen

AHF71022.1A

Accession AHF71022.1A
Species Artemisia annua
Common Name Sweet Wormwood
Description defensin-like protein, partial sequence
IUIS Name Art an 1
Gi
Length 44
Year Adopted 2021
Sequence >AHF71022.1A Allergen Art an 1; defensin-like protein, partial sequence [Artemisia annua]
TWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSK
Parent Accession AHF71022.1