Powered by FoodRisk.org

Allergen

AHF71023.1A

Accession AHF71023.1A
Species Artemisia californica
Common Name California sagebrush
Description defensin-like protein, partial sequence
IUIS Name Art c 1
Gi
Length 39
Year Adopted 2021
Sequence >AHF71023.1A Allergen Art c 1; defensin-like protein, partial sequence [Artemisia californica]
CDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSK
Parent Accession AHF71023.1