Powered by FoodRisk.org

Allergen

AHW81906.1

Accession AHW81906.1
Species Morus alba var. atropurpurea
Common Name White Mulberry
Description 18 kDa winter accumulating protein [Morus alba var. atropurpurea]
Gi 0610664572
Length 157
Year Adopted 2015
Sequence >accession|AHW81906.1|Putative 18 kDa winter accumulating protein [Morus alba var. atropurpurea]
MGVFTFDDEFPSTVAPARFFKAAVLDADNLFPKVAPQAAKSAETVEGNGGPGTVKKITLP
DGKYVKQRLDSIDHDNFTYGHSIIEGDVLSADIEKISHVTKFVASSSGGSIIKVTTTFHT
VGNAPVDEAKAKEGKEKAEGLFKLVEGYLEANPSAYN