Allergen

AHY24648.2

Accession AHY24648.2
External DB Link NCBI Protein
Species Canis familiaris
Common Name dog
Description lipocalin
IUIS Name Can f 4
Length 174
Year Adopted 2019
Sequence >AHY24648.2 Can f 4; lipocalin [Canis familiaris]
MKILLLCLALVLASDAQLPLPNVLTQVSGPWKTLYVSSNNLDKIGENGPFRIYLRGINVD
IPRLKMLFNFYVKVDGECVENSVGASIGRDNLIKGEYNGGNYFRIIDMTPNALIGYDVNV
DSKGKITKVALLMGRGAHVNEEDIAKFKKLSREKGIPEENIIYLGDTDNCPNHE
Parent Accession
Notes This entry replaces an older version of the same Accession # AHY24648.1 (Accession # AHY24648.1 has thus been discontinued from COMPARE2019, in the database and the corresponding 2019 FastA file). The two versions of the sequence differ by one amino acid (position 162). The sequence in the supporting article reviewed this year (PMID: 24859823) matches the most up to date record (AHY24648.2).

Related Articles

Pubmed Authors Title Journal
24859823 Niemi,M.H.; Rytkonen-Nissinen,M.; Janis,J.; Virtanen,T.; Rouvinen,J.; Structural aspects of dog allergies: The crystal structure of a dog dander allergen Can f 4 Mol. Immunol. 61 (1), 7-15 (2014)