Powered by FoodRisk.org

Allergen

AIV43661.1

Accession AIV43661.1
Species Bassia scoparia
Common Name Summer Cypress
Description Koc s 2.0101 profilin, partial
Gi
Length 133
Year Adopted 2019
Sequence >accession|AIV43661.1|Koc s 2.0101 profilin, partial [Bassia scoparia]
MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG
TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI
VERLGDYLVEQGM