Powered by FoodRisk.org

COMPARE Database

AIV43662.1

Accession AIV43662.1
Species Vachellia farnesiana
Common Name Sheep'S Briar
Description Aca f 2 profilin, partial
Gi
Length 133
Year Adopted 2019
Sequence >accession|AIV43662.1|Aca f 2 profilin, partial [Vachellia farnesiana]
MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG
TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI
VERLGDYLVEQGM