Powered by FoodRisk.org

Allergen

AKH04310.1

Accession AKH04310.1
Species Periplaneta americana
Common Name American cockroach
Description alpha-amylase [Periplaneta americana]
Gi 0821092692
Length 494
Year Adopted 2016
Sequence >accession|AKH04310.1|Allergen alpha-amylase [Periplaneta americana]
MKLFALLALVVLLAGVQSQKDPKLVPDESTLLRLFEWKFDDIADECERFLAPKGYAGVQV
SPVHKNLLYTATAPGLWERYQPMSYKLVSRSGDETAFRDMVRRCNAVGVRIYVDVVLNHM
SGNWDNAVGTGGSTADTYNYSYPGVPYDHSDFHPYCILNDYQDPEIVRNCELVGLHDLDQ
SQDYVREKLIDFLNHLVDAGVAGFRVDAAKHMWPADLEYIYGKVNNRNSDAGYCGDSSPS
RYQEVIDLGGEAVSKFEYNGFGRVTEFKHSEQIGYAFRGNNRLEWTYTYKPNWGLLPSGD
ALVFVDNHDNQRGGGNAILTYKTPKNYKMAIAFILAHPYGYPRVMSSFDFEAHDQGPPQD
SDKNILSPSINADGTCGNGWVCEHRWRQHANMVGFRNAVRGTEITNWWDNGNHQIGFCRG
DRGFVAFNVEDNDLKQTLQTCLPAGTYCDVISGSKNNRAHLGAELVVAPNGEAFSVRLIS
DDDGVLAIHLEEKL