Powered by FoodRisk.org

Allergen

AKH04311.1

Accession AKH04311.1
Species Periplaneta americana
Common Name American cockroach
Description chitinase [Periplaneta americana]
Gi 0821092694
Length 407
Year Adopted 2016
Sequence >accession|AKH04311.1|Allergen chitinase [Periplaneta americana]
MKLTSLVAVGVGVFLAAALQTCKGFIRDFKTHRQLQEKGDDRAVFCYYGSWATYRWGIAT
FEVDNIDTRLCTHIVYAFTGLRDGVIVSLDEYNDYEENWGKGLMKKFTTLAKNNGIKALV
GLGGWNEGSVKYSEMAATQAGRETFADSAVAFLQKQGFDGLDLDWEYPARRGGVPEDKDN
FTLLLKTLSEKLHARGLILTVAVSADPKTAANAYDFPNVAKYADYITLMSFDYHTPSSDT
VTGLNSPLDSLPQDTGYNKKLNVKYSVNQWLKGGVPPNKLVLGVPLYGRTYRLADPDQHG
LGAPILGPGTAGLYTQEAGFLAYYEICSNPDWNVVWNDTSSYLYAYKDYQWLSYDDPNTI
TIKAQWVLEKNLGGVMVWSLESDDFHGNCGKGAYPLLTAVNKALGRL