Powered by FoodRisk.org

Allergen

AKJ77985.1

Accession AKJ77985.1
Species Triticum aestivum
Common Name Wheat
Description ElF1 superfamily transcriptions factor [Triticum aestivum]
Gi 0827354784
Length 89
Year Adopted 2016
Sequence >accession|AKJ77985.1|Putative ElF1 superfamily transcriptions factor [Triticum aestivum]
MGKRKAAAKPPPRKGMDKLDTVFSCPFCNHGSSVECRIDLKNLIGEANCQICQESFSTTA
NALTEAIDVYSEWIDECERVNTVEGDDGA