Powered by FoodRisk.org

Allergen

AKJ77990.1

Accession AKJ77990.1
Species Triticum aestivum
Common Name Wheat
Description endosperm transfer cell specific PR60 precursor [Triticum aestivum]
Gi 0827354912
Length 107
Year Adopted 2016
Sequence >accession|AKJ77990.1|Putative endosperm transfer cell specific PR60 precursor [Triticum aestivum]
MAKLMCLCFIILTIAVVVSADECEGDRQEMIKQCAKYQQWPANPKVNPSDACCAVWQKAN
IPCLCAGVTKEKEKIWCMEKVAYVANFCKKPFPHGYKCGSYTFPPLA