Allergen

AKV72166.1

Accession AKV72166.1
Species Acacia farnesiana
Common Name Acacia Pollen
Description Ole e 1-like protein
IUIS Name Aca f 1
Gi
Length 150
Year Adopted 2018
Sequence >AKV72166.1 Allergen Aca f 1; Ole e 1-like protein [Acacia farnesiana]
DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD
KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA
NALGFMRKEPLPECPEVLKEKLDMYDVKAN
Parent Accession