Powered by FoodRisk.org

Allergen

AKV72166.1

Accession AKV72166.1
Species Acacia farnesiana
Common Name Acacia Pollen
Description allergen Aca f 1, partial
IUIS Name
Gi
Length 150
Year Adopted 2018
Sequence >AKV72166.1 allergen Aca f 1, partial [Acacia farnesiana]
DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD
KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA
NALGFMRKEPLPECPEVLKEKLDMYDVKAN
Parent Accession