Powered by FoodRisk.org

Allergen

ALM24136.1

Accession ALM24136.1
Species Rhizopus oryzae
Common Name Bread mold
Description cyclophilin A
IUIS Name Rhi o 2
Gi
Length 164
Year Adopted 2021
Sequence >ALM24136.1 Allergen Rhi o 2; cyclophilin A [Rhizopus oryzae]
MSNPKVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFGYKGCSF
HRVIPEFMLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTGPGDLSMANAGPN
TNGSQFFITTIKCSWLDGKHVVFGRVTEGMDVVQNIESLGSPNGTPRAKIIID
NCGQL
Parent Accession