Allergen

ALM30773.1

Accession ALM30773.1
Species Amphioctopus fangsiao
Common Name Octopus
Description triose phosphate isomerase
IUIS Name
Gi
Length 247
Year Adopted 2018
Sequence >ALM30773.1 triose phosphate isomerase [Amphioctopus fangsiao]
MGRKFFVGGNWKLNGNKKSIDGIIEFMNAGPLNADTEVVVGPPSCYLEYVRSKLKGNIGV
AAQNCYKVPSGAFTGDISPAMIKDIGLRYVILGHSERRNVFGETDELIGEKIEHAVSEGL
IVIACIGEKLEEREAGKTEEVVFSQTKTIIKHTKDWSKVVIAYEPIWAIGTGKTATPEQA
QSVHASLRKFISENASKEIADNVRILYGGSVSAANCKELGQKPDIDGFLVGGASLKPDFV
KIVNARA
Parent Accession